PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn142371
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family MYB_related
Protein Properties Length: 442aa    MW: 49974 Da    PI: 7.3809
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn142371genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding30.77.1e-101445132
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmg 32
                     rg+WT+eEd++l++++  +G g+W++ ++  g
       Achn142371 14 RGPWTPEEDKILINYISHYGHGNWRALPKQAG 45
                     89************************999877 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.3E-13544IPR009057Homeodomain-like
SuperFamilySSF466894.42E-9845IPR009057Homeodomain-like
PROSITE profilePS500907.8059147IPR017877Myb-like domain
SMARTSM007173.0E-1213149IPR001005SANT/Myb domain
PfamPF002494.4E-81445IPR001005SANT/Myb domain
CDDcd001672.92E-51645No hitNo description
SuperFamilySSF466893.66E-7122156IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.6E-11122148IPR009057Homeodomain-like
CDDcd001679.19E-5124147No hitNo description
PfamPF117089.6E-12355417IPR021715Pre-mRNA splicing Prp18-interacting factor
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 442 aa     Download sequence    Send to blast
MVRAPCCEKM GVKRGPWTPE EDKILINYIS HYGHGNWRAL PKQAGISKFP SGFFWVSKFQ  60
SEFVFVSKFP SGFFSVSKFP SGFLFGYKFP SRSKFQSGFL FISKLTSGFF SISKFPSGFL  120
SKMWSAIAAR LPGRTDNEIK NMWHTHLKKR VLKENHQATT LETKPQNYVK PEPLDYPIPV  180
RPQSPQHSSS TTATSETTAI TSTNNGALDN FPNLDENFWE NVFSADDSVA FKSREDDRKQ  240
LELEEARKAG LAPAEVDEDG KEISPHIPQY MSSASWYLHS ERPKEIPEGA TTKKLEERNC  300
NQNGNDGVSD DEDNEDDRKV DEARVDESKR MGFAKVEKPV RTTGGGSTGT VSSVQAELVY  360
KNYKINKEKL KSQVKETIVE KYGNAASDQH FPRELLLGQS EREVEYDHVG RVIKGQFTAE  420
DMEAYGMKRV HRDDPVKDFL N*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA1737334
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G31180.11e-36myb domain protein 14